PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00079501001
Common NameGSBRNA2T00079501001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 325aa    MW: 36771.4 Da    PI: 6.7257
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00079501001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.6e-322478155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprl+Wt+eLH+rF+eav+qLGG++kAtPk ++++m+++gLtl+h+kSHLQkYRl
  GSBRNA2T00079501001 24 KPRLKWTCELHQRFIEAVNQLGGPNKATPKGLMKAMEIPGLTLYHLKSHLQKYRL 78
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.4182181IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-282278IPR009057Homeodomain-like
SuperFamilySSF466891.54E-152378IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-222479IPR006447Myb domain, plants
PfamPF002491.3E-62677IPR001005SANT/Myb domain
PfamPF143791.4E-22126172IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MESNTNNGNN HKAKVSLVLS TDAKPRLKWT CELHQRFIEA VNQLGGPNKA TPKGLMKAME  60
IPGLTLYHLK SHLQKYRLGK SLKFDDNKLE VSSASETQEA ESKNDSGNFR GNVNQENNDP  120
ANEGLKITEA LQLQMEVQKK LHEQIEVQRH LQVKIEAQGK YLQSVLMKAQ QTLAGYTSAS  180
LGMDFARSEL SRLASMMNPS SSFSEQTQVE DYEEEGFLWC KKPENREKRQ PRSSVESSLT  240
SSESSETKLN NNNEERKSME LPLMEIKSEA MMAKKTKRSL NDVLCVEHQP LKKRDFGVDD  300
DDEQHLRLSL NSYKQDMGTC PNMD*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00079501001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013717046.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X2
RefseqXP_009127744.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A078I1Z00.0A0A078I1Z0_BRANA; BnaA02g14410D protein
STRINGBra007867.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38782759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.11e-159G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]